PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462938551
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 655aa    MW: 73512.9 Da    PI: 6.5302
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462938551genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.71.2e-10392441756
                --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                + +  +e+L ++F++n  p ++ +e+L+++l+++ +++  WF+N R kek
  462938551 392 IPPAAVEVLRKAFAENELPPRNVKEDLSRQLDISFEKIDKWFKNTRLKEK 441
                567789******************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-11374441IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-11378441IPR009057Homeodomain-like
PROSITE profilePS5007113.572383443IPR001356Homeobox domain
SMARTSM003897.4E-9385447IPR001356Homeobox domain
CDDcd000865.60E-9386441No hitNo description
PfamPF000462.7E-8391441IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 655 aa     Download sequence    Send to blast
MDSSEKKLVC SNSGRSSQRR KQSAAKSATV STKPCRRNAP RKCKPDSRFK RSPRKVKNAT  60
LAKCIRNKYH CSPQKQQRGS DSVAGKRKRK RKRQNTDEMT RLERRAKYFL IKIKFEQNLL  120
DAYSGDGWNG QRARYFLIKI KCEQNLLDAY SGDGWNGQSR EKIKPQKELQ RAKKQIIKYK  180
IAIRDVIHQL DLSNSSGSIS DLAMPADGSV VEHDIFKEAT ETIDSEGGLD EDWLSEYSGD  240
EDYDPEENEV SSSSSRSIDS GEGVMSDGSS GSGSPLYSPN DDIPDFISAD FNDAEGLCNT  300
YLDLSVDCGD DDVPQILTYQ RPRRDVDYRR LNDEMFGKLI ENEEQSEDED WGGYKRKKRR  360
VNSAVVGVNS VEGFSNDIDG KVQKQRRKLF RIPPAAVEVL RKAFAENELP PRNVKEDLSR  420
QLDISFEKID KWFKNTRLKE KVTIQHRAKD PEQAEENSHT SPSNSSRTNE EAGISAMVDL  480
VDNSYFVPLS EIINVPARLQ KNLEKRKAES TISSLRRLHD NGSCSFPTGQ VKERPSPGNN  540
SCLGEDSSHP INTGALTCLQ GTTSPKSQSC LLTDLSHPTN NEVSCEEQVA SCMDAGISDY  600
QPFLDVIDEM CVLENRLQML RENMLSSGSV GANDESDLQN QTVVLVPAAE LKEKA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18691RKRKRK
28692RKRKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626817.11e-177PREDICTED: pathogenesis-related homeodomain protein
TrEMBLA0A096QB180.0A0A096QB18_MAIZE; Uncharacterized protein
STRINGGRMZM2G033138_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85502227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.11e-20pathogenesis related homeodomain protein A